PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr8P04280_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family Nin-like
Protein Properties Length: 711aa    MW: 79318.9 Da    PI: 6.7969
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr8P04280_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK88.55.5e-28432482252
                 RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                            ek+isle l++yFs+++kdAAk+Lgvc+T++KriCR++GI+RWP+Rki+++
  GSMUA_Achr8P04280_001 432 EKTISLELLQQYFSGNLKDAAKSLGVCPTTMKRICRHHGISRWPSRKINKV 482
                            799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.904421502IPR003035RWP-RK domain
PfamPF020421.1E-25434482IPR003035RWP-RK domain
SuperFamilySSF542776.54E-23598688No hitNo description
SMARTSM006668.2E-24603685IPR000270PB1 domain
PROSITE profilePS5174523.227603685IPR000270PB1 domain
CDDcd064071.09E-35604684No hitNo description
Gene3DG3DSA:3.10.20.2402.7E-24604685No hitNo description
PfamPF005642.0E-16604684IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 711 aa     Download sequence    Send to blast
MADSKAMELQ VPAVEEFSDG SFVIKERMTQ ALRYFKESTD HHVLVQVWAP VKNGDRCVLT  60
TLGQPFILDP ESTKLLQYRT VSLMYIFSVD EDDDADLGLP GRVFTRRMPE WTPNVQYYSS  120
KEYQRLNHAL CYNVQGTLAL PVFEPSGQSC IGVVEVVMTS QKVNYAYEVD KVCKALEAVN  180
LKSSEILDHP NVLIANDGHQ AALAEILEIL TLVCEAKKLP LAQTWVPCRH QTVLTHGGGP  240
KKICSRFDGS CMGQVCMSTT DVAFYIIDPH LWGFREACVE HHLQKGQGVA GKTFAQRRPC  300
FSKDITKYCK SEYPLVHYAR MFGLAGCLAI CLRSNHLGDD DYILEFFLPA DCKSPGEQQD  360
LLNSISGLLK QCFQNLKFIT EVKLIYSPRG DTHVHIPSEA NIDEPNGNKL LDSTALDNKT  420
SYIPAKRRGK PEKTISLELL QQYFSGNLKD AAKSLGVCPT TMKRICRHHG ISRWPSRKIN  480
KVNRSLSKLK HVIESVQGAG SLDLTSLSCP LPVAVDSVPW PVDLDSLKDL QDGVKRSEFC  540
SCQGSPVNNF FVSSQPAFLL NENSLPVAVN SKPQLPVGVL IKDSGSSKEL KINCTFAGVE  600
TKALTIKASY KEDIIRFRLP HNAGILALKD EISKKLKLEV GTFDIKYLDD DHEWVMLTCD  660
WDLEECLDVS RSSGAHIIRL SVHDTVTNLG SSCESSEVDY HNYVTRQFNV G
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009412372.10.0PREDICTED: protein NLP3-like isoform X2
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLM0TMI10.0M0TMI1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P04280_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein